"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q27J47"	"{'domain_architectures': 140214, 'entries': 15, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'smart': 1, 'cdd': 1, 'profile': 1, 'pfam': 1, 'cathgene3d': 1, 'panther': 1, 'prints': 1, 'prosite': 2, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 140214}"	"['Snake venom serine protease that activates plasminogen. Weakly hydrolyzes the alpha chain of human fibrinogen without releasing fibrinopeptide A. Does not hydrolyze plasma kallikrein or factor Xa. Does not clot fibrinogen. Does not affect platelet function. Induces hypotensive effects on rats. Shows a preferential cleavage at Lys-|-Xaa over Arg-|-Xaa bonds']"	""	"[{'identifier': 'GO:0004252', 'name': 'serine-type endopeptidase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006508', 'name': 'proteolysis', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"VSPPA_LACMU"	"9eb5193692395549c59ea14a515b8bb2c75cc329"	True	False	False	258	"Venom plasminogen activator LV-PA"	1	""	"MVLITVLANLLILQLSYAQKSSKLVFGGDECNINEHRSLVVLFNSSGFLCAGTLINKEWVLTAAHCDSENFQMQLGVHSKKVPNKDEETRDPKEKFICPNRKKNDEKDKDIMLIRLNRPVSNSEHIALLSLPSSPPSVGSVCRIMGWGTISPTKEIYPDVPHCADINILDHAVCRAAYSGWLATSTTLCAGILEGGKDSCHGDSGGPLICNGQFQGIVSLGRHPCGHPDEPGVYTKVFDYTDWIQSIIAGNTDAACPP"	"reviewed"	"{'taxId': '8753', 'scientificName': 'Lachesis muta muta', 'fullName': 'Lachesis muta muta (Bushmaster)'}"
