General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q24T29",
        "id": "CSRA_DESHY",
        "source_organism": {
            "taxId": "138119",
            "scientificName": "Desulfitobacterium hafniense (strain Y51)",
            "fullName": "Desulfitobacterium hafniense (strain Y51)"
        },
        "name": "Translational regulator CsrA",
        "description": [
            "A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW"
        ],
        "length": 77,
        "sequence": "MLALTRKAGERIVIGDNIVVTVVSIKGDSIRLTIDAPKEVKIYRGEIYDAIAAENKEAAVPMDLTELTALKEFHIRK",
        "proteome": "UP000001946",
        "gene": "csrA",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006109",
                "name": "regulation of carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006402",
                "name": "mRNA catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8f5d762c6069be76d422cca0ae75ff7ca467bf68",
        "counters": {
            "domain_architectures": 11354,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "ncbifam": 2,
                "panther": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11354
        }
    }
}