"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q24T29"	"{'domain_architectures': 11354, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'ncbifam': 2, 'panther': 1, 'hamap': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 11354}"	"[""A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'-UTR at or near the Shine-Dalgarno sequence preventing ribosome-binding, thus repressing translation. Its main target seems to be the major flagellin gene, while its function is anatagonized by FliW""]"	"csrA"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006109', 'name': 'regulation of carbohydrate metabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0006402', 'name': 'mRNA catabolic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"CSRA_DESHY"	"8f5d762c6069be76d422cca0ae75ff7ca467bf68"	True	False	False	77	"Translational regulator CsrA"	3	"UP000001946"	"MLALTRKAGERIVIGDNIVVTVVSIKGDSIRLTIDAPKEVKIYRGEIYDAIAAENKEAAVPMDLTELTALKEFHIRK"	"reviewed"	"{'taxId': '138119', 'scientificName': 'Desulfitobacterium hafniense (strain Y51)', 'fullName': 'Desulfitobacterium hafniense (strain Y51)'}"