GET /api/protein/UniProt/Q1G852/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q1G852",
"id": "DLTC_LACDA",
"source_organism": {
"taxId": "390333",
"scientificName": "Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)",
"fullName": "Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)"
},
"name": "D-alanyl carrier protein",
"description": [
"Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall"
],
"length": 80,
"sequence": "MDIQKQIVDILAEATGEDFSDNMDQELYESGIMDSMTTVQMLLTLQETFDITVPVSEFNRDDWNTPNKLVEQVKKLQDEE",
"proteome": "UP000001259",
"gene": "dltC",
"go_terms": [
{
"identifier": "GO:0036370",
"name": "D-alanyl carrier activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019350",
"name": "teichoic acid biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3c9e8d520e54d5947b224319c71493893473a1da",
"counters": {
"domain_architectures": 82947,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"ncbifam": 2,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 82947
}
}
}