"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q1G852"	"{'domain_architectures': 82947, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'profile': 1, 'cathgene3d': 1, 'ssf': 1, 'pfam': 1, 'ncbifam': 2, 'hamap': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 82947}"	"['Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall']"	"dltC"	"[{'identifier': 'GO:0036370', 'name': 'D-alanyl carrier activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019350', 'name': 'teichoic acid biosynthetic process', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"DLTC_LACDA"	"3c9e8d520e54d5947b224319c71493893473a1da"	True	False	False	80	"D-alanyl carrier protein"	3	"UP000001259"	"MDIQKQIVDILAEATGEDFSDNMDQELYESGIMDSMTTVQMLLTLQETFDITVPVSEFNRDDWNTPNKLVEQVKKLQDEE"	"reviewed"	"{'taxId': '390333', 'scientificName': 'Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)', 'fullName': 'Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / BCRC 10696 / JCM 1002 / NBRC 13953 / NCIMB 11778 / NCTC 12712 / WDCM 00102 / Lb 14)'}"