General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q1D3H1",
        "id": "BACO_MYXXD",
        "source_organism": {
            "taxId": "246197",
            "scientificName": "Myxococcus xanthus (strain DK1622)",
            "fullName": "Myxococcus xanthus (strain DK1622)"
        },
        "name": "Bactofilin BacO",
        "description": [
            "A non-essential component of the chromosome segregation machinery (PubMed:29180656). Positions the ParA-ParB-parS chromosome segregation machinery within the cell; BacP seems to be the most important bactofilin in this process (PubMed:29180656). Forms a heteropolymeric, subpolar scaffold in the cell; BacP probably forms the core, BacO contributes to position and integrity while BacN does not seem to contribute to assembly (PubMed:29180656)"
        ],
        "length": 126,
        "sequence": "MSFTPRTARHTPFERRTTLMANTVIGSSIVIDGEISGDEDLVIQGTVKGKISLKESLYVEGSGVVEADIETQNVEIAGRVTGNIVASDKVELKTDCRVVGDIKAPRILIADGASFKGNVDMDMKER",
        "proteome": "UP000002402",
        "gene": "bacO",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "903e8cc99451e5b44d44dec70de22d2d82bb50c5",
        "counters": {
            "domain_architectures": 12660,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12660
        }
    }
}