"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q1D3H1"	"{'domain_architectures': 12660, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'panther': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 12660}"	"['A non-essential component of the chromosome segregation machinery (PubMed:29180656). Positions the ParA-ParB-parS chromosome segregation machinery within the cell; BacP seems to be the most important bactofilin in this process (PubMed:29180656). Forms a heteropolymeric, subpolar scaffold in the cell; BacP probably forms the core, BacO contributes to position and integrity while BacN does not seem to contribute to assembly (PubMed:29180656)']"	"bacO"	""	"BACO_MYXXD"	"903e8cc99451e5b44d44dec70de22d2d82bb50c5"	True	False	False	126	"Bactofilin BacO"	1	"UP000002402"	"MSFTPRTARHTPFERRTTLMANTVIGSSIVIDGEISGDEDLVIQGTVKGKISLKESLYVEGSGVVEADIETQNVEIAGRVTGNIVASDKVELKTDCRVVGDIKAPRILIADGASFKGNVDMDMKER"	"reviewed"	"{'taxId': '246197', 'scientificName': 'Myxococcus xanthus (strain DK1622)', 'fullName': 'Myxococcus xanthus (strain DK1622)'}"