General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q10446",
        "id": "GID8_SCHPO",
        "source_organism": {
            "taxId": "284812",
            "scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)",
            "fullName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)"
        },
        "name": "GID complex subunit 8",
        "description": [
            "Component of the GID E3 ligase complex recruiting N termini and catalyzing ubiquitination of proteins targeted for degradation. GID E3 is regulated through assembly with interchangeable N-degron-binding substrate receptors induced by distinct environmental perturbations. Required for the adaptation to the presence of glucose in the growth medium; mediates in association with the substrate receptor VID24/GID4 the degradation of enzymes involved in gluconeogenesis when cells are shifted to glucose-containing medium"
        ],
        "length": 240,
        "sequence": "MVGTSSLDISMSGSSSSDAEQWEKQTKSVHIDNSDVNSLILDYLVIQGDEEAAKTFAEEAQITDYYIPPYVKERLEICELIKSGSINSAICKLNELEPEILDTNSELLFELLRLRLLELIREVVEEKDTSDLAVERCLNFAHENLAPLAPSNQKFLNSLELTMSLLCFPPSSYSPALKNVLNYSQRERVANLANVSILKSQGLSNESRLLSLVNFERWCEKEAQRNSIEVQKFVPKASIK",
        "proteome": "UP000002485",
        "gene": "gid8",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2e73de1ff3aa0698bae3821ac409afcc0fb436d7",
        "counters": {
            "domain_architectures": 4465,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 3,
                "profile": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4465
        }
    }
}