"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q10446"	"{'domain_architectures': 4465, 'entries': 13, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 3, 'profile': 2, 'pfam': 2, 'panther': 1, 'interpro': 5}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 4465}"	"['Component of the GID E3 ligase complex recruiting N termini and catalyzing ubiquitination of proteins targeted for degradation. GID E3 is regulated through assembly with interchangeable N-degron-binding substrate receptors induced by distinct environmental perturbations. Required for the adaptation to the presence of glucose in the growth medium; mediates in association with the substrate receptor VID24/GID4 the degradation of enzymes involved in gluconeogenesis when cells are shifted to glucose-containing medium']"	"gid8"	"[{'identifier': 'GO:0005515', 'name': 'protein binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"GID8_SCHPO"	"2e73de1ff3aa0698bae3821ac409afcc0fb436d7"	True	False	False	240	"GID complex subunit 8"	3	"UP000002485"	"MVGTSSLDISMSGSSSSDAEQWEKQTKSVHIDNSDVNSLILDYLVIQGDEEAAKTFAEEAQITDYYIPPYVKERLEICELIKSGSINSAICKLNELEPEILDTNSELLFELLRLRLLELIREVVEEKDTSDLAVERCLNFAHENLAPLAPSNQKFLNSLELTMSLLCFPPSSYSPALKNVLNYSQRERVANLANVSILKSQGLSNESRLLSLVNFERWCEKEAQRNSIEVQKFVPKASIK"	"reviewed"	"{'taxId': '284812', 'scientificName': 'Schizosaccharomyces pombe (strain 972 / ATCC 24843)', 'fullName': 'Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)'}"