GET /api/protein/UniProt/Q10241/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "Q10241",
"id": "CMB1_SCHPO",
"source_organism": {
"taxId": "284812",
"scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)",
"fullName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)"
},
"name": "Cytosine-containing mismatch-binding protein 1",
"description": [
"Binds to cytosines in base mismatches and opposite chemically altered guanines. May be involved in repair of DNA damage"
],
"length": 199,
"sequence": "MVFAIRIRQFHTTLVSAEKNGLQKLIPPRLKTIWNQMLVETKGAGNGPERFEMIRQKYKALTADEIQKYKNKLQEQFDAEKKRFMETLRSFTPTEIDSENRRRSKEAHSTGSRYYRLRHPDVPKKPSSAFILFYKELRNNPKLRQELGIPEAISTLVEETQNASKAWKELAEDKKKPFIDKSKALKEQYDKFMKEAGFR",
"proteome": "UP000002485",
"gene": "cmb1",
"go_terms": null,
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "dd09300e458bbcfa6dbbb410c0677c784ab0bae7",
"counters": {
"domain_architectures": 1763,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1763
}
}
}