General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q10241",
        "id": "CMB1_SCHPO",
        "source_organism": {
            "taxId": "284812",
            "scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)",
            "fullName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)"
        },
        "name": "Cytosine-containing mismatch-binding protein 1",
        "description": [
            "Binds to cytosines in base mismatches and opposite chemically altered guanines. May be involved in repair of DNA damage"
        ],
        "length": 199,
        "sequence": "MVFAIRIRQFHTTLVSAEKNGLQKLIPPRLKTIWNQMLVETKGAGNGPERFEMIRQKYKALTADEIQKYKNKLQEQFDAEKKRFMETLRSFTPTEIDSENRRRSKEAHSTGSRYYRLRHPDVPKKPSSAFILFYKELRNNPKLRQELGIPEAISTLVEETQNASKAWKELAEDKKKPFIDKSKALKEQYDKFMKEAGFR",
        "proteome": "UP000002485",
        "gene": "cmb1",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dd09300e458bbcfa6dbbb410c0677c784ab0bae7",
        "counters": {
            "domain_architectures": 1763,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1763
        }
    }
}