"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q10241"	"{'domain_architectures': 1763, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'smart': 1, 'profile': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1763}"	"['Binds to cytosines in base mismatches and opposite chemically altered guanines. May be involved in repair of DNA damage']"	"cmb1"	""	"CMB1_SCHPO"	"dd09300e458bbcfa6dbbb410c0677c784ab0bae7"	True	False	False	199	"Cytosine-containing mismatch-binding protein 1"	1	"UP000002485"	"MVFAIRIRQFHTTLVSAEKNGLQKLIPPRLKTIWNQMLVETKGAGNGPERFEMIRQKYKALTADEIQKYKNKLQEQFDAEKKRFMETLRSFTPTEIDSENRRRSKEAHSTGSRYYRLRHPDVPKKPSSAFILFYKELRNNPKLRQELGIPEAISTLVEETQNASKAWKELAEDKKKPFIDKSKALKEQYDKFMKEAGFR"	"reviewed"	"{'taxId': '284812', 'scientificName': 'Schizosaccharomyces pombe (strain 972 / ATCC 24843)', 'fullName': 'Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)'}"