General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0Z8B6",
        "id": "HJM79_ENTHR",
        "source_organism": {
            "taxId": "1354",
            "scientificName": "Enterococcus hirae",
            "fullName": "Enterococcus hirae"
        },
        "name": "Bacteriocin hiracin-JM79",
        "description": [
            "Bacteriocin with antibacterial activity against the Gram-positive Listeria, Enterococcus, Propionibacterium, Staphylococcus and some strains of Clostridium, Lactobacillus and Pediococcus. Lacks antibacterial activity against Gram-negative bacteria"
        ],
        "length": 74,
        "sequence": "MKKKVLKHCVILGILGTCLAGIGTGIKVDAATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR",
        "proteome": null,
        "gene": "hirJM79",
        "go_terms": [
            {
                "identifier": "GO:0042742",
                "name": "defense response to bacterium",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "254ac404640f9aa9c6f4bf632a7c85a6b457b8a9",
        "counters": {
            "domain_architectures": 270,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 270
        }
    }
}