"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q0Z8B6"	"{'domain_architectures': 270, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 270}"	"['Bacteriocin with antibacterial activity against the Gram-positive Listeria, Enterococcus, Propionibacterium, Staphylococcus and some strains of Clostridium, Lactobacillus and Pediococcus. Lacks antibacterial activity against Gram-negative bacteria']"	"hirJM79"	"[{'identifier': 'GO:0042742', 'name': 'defense response to bacterium', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"HJM79_ENTHR"	"254ac404640f9aa9c6f4bf632a7c85a6b457b8a9"	True	False	False	74	"Bacteriocin hiracin-JM79"	1	""	"MKKKVLKHCVILGILGTCLAGIGTGIKVDAATYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNHGPWAPRR"	"reviewed"	"{'taxId': '1354', 'scientificName': 'Enterococcus hirae', 'fullName': 'Enterococcus hirae'}"