General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0VCG0",
        "id": "LYRM4_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "LYR motif-containing protein 4",
        "description": [
            "Stabilizing factor, of the core iron-sulfur cluster (ISC) assembly complex, that regulates, in association with NDUFAB1, the stability and the cysteine desulfurase activity of NFS1 and participates in the [2Fe-2S] clusters assembly on the scaffolding protein ISCU (By similarity). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN-dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (By similarity). May also participates in the iron-sulfur protein biogenesis in the cytoplasm through its interaction with the cytoplasmic form of NFS1 (By similarity)"
        ],
        "length": 91,
        "sequence": "MAASSRAQVLDLYRAMLRESKRFGAYNYRTYAIRRIRDAFRENKNVKDPVEIQALVNKAKRDLGIIRRQVHIGQMYSTDKLVIENQEKPRA",
        "proteome": "UP000009136",
        "gene": "LYRM4",
        "go_terms": [
            {
                "identifier": "GO:0016226",
                "name": "iron-sulfur cluster assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8f2d10ec74c5645583df816b973bc6cd2b0857e5",
        "counters": {
            "domain_architectures": 22521,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 22521
        }
    }
}