"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q0VCG0"	"{'domain_architectures': 22521, 'entries': 6, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cdd': 1, 'panther': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 22521}"	"['Stabilizing factor, of the core iron-sulfur cluster (ISC) assembly complex, that regulates, in association with NDUFAB1, the stability and the cysteine desulfurase activity of NFS1 and participates in the [2Fe-2S] clusters assembly on the scaffolding protein ISCU (By similarity). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN-dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (By similarity). May also participates in the iron-sulfur protein biogenesis in the cytoplasm through its interaction with the cytoplasmic form of NFS1 (By similarity)']"	"LYRM4"	"[{'identifier': 'GO:0016226', 'name': 'iron-sulfur cluster assembly', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"LYRM4_BOVIN"	"8f2d10ec74c5645583df816b973bc6cd2b0857e5"	True	False	False	91	"LYR motif-containing protein 4"	3	"UP000009136"	"MAASSRAQVLDLYRAMLRESKRFGAYNYRTYAIRRIRDAFRENKNVKDPVEIQALVNKAKRDLGIIRRQVHIGQMYSTDKLVIENQEKPRA"	"reviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"