General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q0IHT3",
        "id": "CRTC3_XENTR",
        "source_organism": {
            "taxId": "8364",
            "scientificName": "Xenopus tropicalis",
            "fullName": "Xenopus tropicalis (Western clawed frog)"
        },
        "name": "CREB-regulated transcription coactivator 3",
        "description": [
            "Transcriptional coactivator for creb1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of creb1 'Ser-119' phosphorylation. Enhances the interaction of creb1 with taf4. Regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. Potent coactivator of ppargc1a and inducer of mitochondrial biogenesis in muscle cells (By similarity)"
        ],
        "length": 637,
        "sequence": "MAATPAASGSNPRKFSEKIALHNQKQAEETRAFDELMSDLTVSRVQFQKLQQLRLAQSRAQYYGGSLPNVNQISSSPTDFQPSFHPTDNIRGMRHHGLVERVSRNRLHSSHHRPIEKHGRQCDSSPYGSVYLSPPPDNNWRRTNSDSALHTSASSTKSQDPFMGGAQAMLRAPKPPQRNTSLQDGEIDNFGEVFSFPNAMTEENMLNVTKPLPKQIWEAQKVQCITSRPRSCEVPNIKVFPSSDSNASLSHFQGSLNTGGSLPDLTNLHFPSPLPTPLDPDDTAYANISAENSSGLPAAMTHLGISGSPGMQNTRSNPSIQATMNNNSLASNVNSHTPPGRNNPALHPSLRLSSLSNPSLPTSALGTSPRRRHTPVSPLTLTPGSESNRSISNQFSPTSPMNMPPNSQGVSMDRSPLSLPPLEPPPPYPLYSDQPQPHLHHTQQQMHESLDSQNYQPPSPVPCPPLDLNLANSSLSGFFGDSFFDQQQPTKQGKYLWQQQEQYDMFGSPSSSLPNTNAFFDPNMNLQYSQASLMGLGGSHGSLQDSFHLRPNYLYSNCGGSVPNIILTDDSSNSLSKDISNAVAGVSELGFDADNTFQLDDELKLGPLSLDGLSMLSDPDMVLPDPSIEDSFRSDKL",
        "proteome": "UP000008143",
        "gene": "crtc3",
        "go_terms": [
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0008140",
                "name": "cAMP response element binding protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051289",
                "name": "protein homotetramerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3148b27c77231e098c12fc5f0c5af7f632beff08",
        "counters": {
            "domain_architectures": 2107,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 3,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2107
        }
    }
}