GET /api/protein/UniProt/Q031I6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q031I6",
        "id": "RECU_LACLS",
        "source_organism": {
            "taxId": "272622",
            "scientificName": "Lactococcus lactis subsp. cremoris (strain SK11)",
            "fullName": "Lactococcus lactis subsp. cremoris (strain SK11)"
        },
        "name": "Holliday junction resolvase RecU",
        "description": [
            "Endonuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves mobile four-strand junctions by introducing symmetrical nicks in paired strands. Promotes annealing of linear ssDNA with homologous dsDNA. Required for DNA repair, homologous recombination and chromosome segregation"
        ],
        "length": 213,
        "sequence": "MVNYPNGRSQSYSAVPKKQKTLTELSVAKKSAPKSKSLVAFGKRGMNFEAEINATNDYYLSRGLAVIHKKPTPIQIVKVDYPQRSRAKITEAYFRQASTTDYSGVYKGHYVDFEAKETHQKTVFPLKNFHEHQIVHMSNVLAQRGIAFVLLHFADLEETYLLPSSYLITFYYEKNGLKSIPLAYIRENGYKIETNHIPRIPYLEIVNKLCEVQ",
        "proteome": null,
        "gene": "recU",
        "go_terms": [
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "aaf3d365e37f4745c39f66c8e11fe16a400f9c9a",
        "counters": {
            "domain_architectures": 4236,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 3,
                "hamap": 1,
                "pirsf": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4236
        }
    }
}