"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q031I6"	"{'domain_architectures': 4236, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'ncbifam': 3, 'hamap': 1, 'pirsf': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 4236}"	"['Endonuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves mobile four-strand junctions by introducing symmetrical nicks in paired strands. Promotes annealing of linear ssDNA with homologous dsDNA. Required for DNA repair, homologous recombination and chromosome segregation']"	"recU"	"[{'identifier': 'GO:0006281', 'name': 'DNA repair', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0003676', 'name': 'nucleic acid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"RECU_LACLS"	"aaf3d365e37f4745c39f66c8e11fe16a400f9c9a"	True	False	False	213	"Holliday junction resolvase RecU"	3	""	"MVNYPNGRSQSYSAVPKKQKTLTELSVAKKSAPKSKSLVAFGKRGMNFEAEINATNDYYLSRGLAVIHKKPTPIQIVKVDYPQRSRAKITEAYFRQASTTDYSGVYKGHYVDFEAKETHQKTVFPLKNFHEHQIVHMSNVLAQRGIAFVLLHFADLEETYLLPSSYLITFYYEKNGLKSIPLAYIRENGYKIETNHIPRIPYLEIVNKLCEVQ"	"reviewed"	"{'taxId': '272622', 'scientificName': 'Lactococcus lactis subsp. cremoris (strain SK11)', 'fullName': 'Lactococcus lactis subsp. cremoris (strain SK11)'}"