GET /api/protein/UniProt/Q02373/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "Q02373",
        "id": "NDUBA_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10",
        "description": [
            "Accessory subunit that is involved in the functional assembly of the mitochondrial respiratory chain complex I. Complex I has an NADH dehydrogenase activity with ubiquinone as an immediate electron acceptor and mediates the transfer of electrons from NADH to the respiratory chain"
        ],
        "length": 176,
        "sequence": "MPDSWDKDVYPEPPRRTPAPSPQTSLPNPITYLTKAFDLLVDRPVTLVREFIERQHAKNKYYYYHREFRRVPDITECQEKDVLCMFEAEMQWRRDYKVDQEIVNIIQERLKACQQREGESHRQNCAKELEQFTQVVKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKAAKEAAAA",
        "proteome": "UP000009136",
        "gene": "NDUFB10",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba62ca972ee00bb18afe391a3292be9bc6706793",
        "counters": {
            "domain_architectures": 2210,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 44,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2210
        }
    }
}