"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q02373"	"{'domain_architectures': 2210, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 44, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 2}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 2210}"	"['Accessory subunit that is involved in the functional assembly of the mitochondrial respiratory chain complex I. Complex I has an NADH dehydrogenase activity with ubiquinone as an immediate electron acceptor and mediates the transfer of electrons from NADH to the respiratory chain']"	"NDUFB10"	""	"NDUBA_BOVIN"	"ba62ca972ee00bb18afe391a3292be9bc6706793"	True	False	False	176	"NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10"	1	"UP000009136"	"MPDSWDKDVYPEPPRRTPAPSPQTSLPNPITYLTKAFDLLVDRPVTLVREFIERQHAKNKYYYYHREFRRVPDITECQEKDVLCMFEAEMQWRRDYKVDQEIVNIIQERLKACQQREGESHRQNCAKELEQFTQVVKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKAAKEAAAA"	"reviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"
