General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P83523",
        "id": "FER_LYCCN",
        "source_organism": {
            "taxId": "112883",
            "scientificName": "Lycium chinense",
            "fullName": "Lycium chinense (Chinese wolfberry)"
        },
        "name": "Ferredoxin",
        "description": [
            "Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions"
        ],
        "length": 97,
        "sequence": "ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSDGNFLDDDQIADGFVLTCVAYPQSDVTIETHKEEALTG",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0051536",
                "name": "iron-sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009055",
                "name": "electron transfer activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051537",
                "name": "2 iron, 2 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0022900",
                "name": "electron transport chain",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fdc269cf1d8d48c0a366de0336ed1429d1ca6486",
        "counters": {
            "domain_architectures": 45276,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 45276
        }
    }
}