"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P83523"	"{'domain_architectures': 45276, 'entries': 13, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'ncbifam': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 45276}"	"['Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions']"	""	"[{'identifier': 'GO:0051536', 'name': 'iron-sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0009055', 'name': 'electron transfer activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0051537', 'name': '2 iron, 2 sulfur cluster binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0022900', 'name': 'electron transport chain', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"FER_LYCCN"	"fdc269cf1d8d48c0a366de0336ed1429d1ca6486"	True	False	False	97	"Ferredoxin"	1	""	"ATYKVKLVTPDGPVEFDCPDDVYILDQAEEEGHELPYSCRAGSCSSCAGKVSAGTVDQSDGNFLDDDQIADGFVLTCVAYPQSDVTIETHKEEALTG"	"reviewed"	"{'taxId': '112883', 'scientificName': 'Lycium chinense', 'fullName': 'Lycium chinense (Chinese wolfberry)'}"
