GET /api/protein/UniProt/P80856/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P80856",
"id": "FABPL_RHASA",
"source_organism": {
"taxId": "55673",
"scientificName": "Rhamdia sapo",
"fullName": "Rhamdia sapo (South American catfish)"
},
"name": "Fatty acid-binding protein, liver",
"description": [
"Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport this L-FABP binds only one fatty acid/molecule. Has more affinity for trans-parinaric acid than for cis-parinaric acid"
],
"length": 126,
"sequence": "MAFSGTWQVYAQENYEEFLRAISLPEDVIKLAKDVKPVTEIQQTGNDFVITSKTPGKSVTNSFTIGKEAEITTMDGRKLKCIVKLEGGKLISETEKFSHKQEIKGGEMIETLTVAGTTMVRKSKKV",
"proteome": null,
"gene": "fabp1",
"go_terms": [
{
"identifier": "GO:0008289",
"name": "lipid binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1923a4eaa303ad6fd9f8e77541e021dd08a540c2",
"counters": {
"domain_architectures": 3464,
"entries": 10,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"pfam": 1,
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3464
}
}
}