General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P80856",
        "id": "FABPL_RHASA",
        "source_organism": {
            "taxId": "55673",
            "scientificName": "Rhamdia sapo",
            "fullName": "Rhamdia sapo (South American catfish)"
        },
        "name": "Fatty acid-binding protein, liver",
        "description": [
            "Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport this L-FABP binds only one fatty acid/molecule. Has more affinity for trans-parinaric acid than for cis-parinaric acid"
        ],
        "length": 126,
        "sequence": "MAFSGTWQVYAQENYEEFLRAISLPEDVIKLAKDVKPVTEIQQTGNDFVITSKTPGKSVTNSFTIGKEAEITTMDGRKLKCIVKLEGGKLISETEKFSHKQEIKGGEMIETLTVAGTTMVRKSKKV",
        "proteome": null,
        "gene": "fabp1",
        "go_terms": [
            {
                "identifier": "GO:0008289",
                "name": "lipid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1923a4eaa303ad6fd9f8e77541e021dd08a540c2",
        "counters": {
            "domain_architectures": 3464,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3464
        }
    }
}