"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P80856"	"{'domain_architectures': 3464, 'entries': 10, 'isoforms': 0, 'proteomes': 0, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'pfam': 1, 'cathgene3d': 1, 'cdd': 1, 'panther': 1, 'prosite': 1, 'prints': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 3464}"	"['Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport this L-FABP binds only one fatty acid/molecule. Has more affinity for trans-parinaric acid than for cis-parinaric acid']"	"fabp1"	"[{'identifier': 'GO:0008289', 'name': 'lipid binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"FABPL_RHASA"	"1923a4eaa303ad6fd9f8e77541e021dd08a540c2"	True	False	False	126	"Fatty acid-binding protein, liver"	1	""	"MAFSGTWQVYAQENYEEFLRAISLPEDVIKLAKDVKPVTEIQQTGNDFVITSKTPGKSVTNSFTIGKEAEITTMDGRKLKCIVKLEGGKLISETEKFSHKQEIKGGEMIETLTVAGTTMVRKSKKV"	"reviewed"	"{'taxId': '55673', 'scientificName': 'Rhamdia sapo', 'fullName': 'Rhamdia sapo (South American catfish)'}"