General Handler

HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "P70687",
        "id": "CP17A_MESAU",
        "source_organism": {
            "taxId": "10036",
            "scientificName": "Mesocricetus auratus",
            "fullName": "Mesocricetus auratus (Golden hamster)"
        },
        "name": "Steroid 17-alpha-hydroxylase/17,20 lyase",
        "description": [
            "A cytochrome P450 monooxygenase involved in corticoid and androgen biosynthesis. Catalyzes 17-alpha hydroxylation of C21 steroids, which is common for both pathways. A second oxidative step, required only for androgen synthesis, involves an acyl-carbon cleavage. The 17-alpha hydroxy intermediates, as part of adrenal glucocorticoids biosynthesis pathway, are precursors of cortisol. Hydroxylates steroid hormones, pregnenolone and progesterone to form 17-alpha hydroxy metabolites, followed by the cleavage of the C17-C20 bond to form C19 steroids, dehydroepiandrosterone (DHEA) and androstenedione. Has 16-alpha hydroxylase activity. Catalyzes 16-alpha hydroxylation of 17-alpha hydroxy pregnenolone, followed by the cleavage of the C17-C20 bond to form 16-alpha-hydroxy DHEA. Also 16-alpha hydroxylates androgens, relevant for estriol synthesis. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase)"
        ],
        "length": 511,
        "sequence": "MWELVALLLLTLAYFFWSKSKTCGAKSPKSLPFLPLVGSLPFIPRHGHPHVNFFKLQEKYGPIYSLRLGSTTTVIIGQYQLAKEVLVKKGKEFSGRPHMVTLGLLSDQGKGIAFADSGGSWQLHRKLALSSFALFRDGNQKLEKIICQKASSLCDFLLTHNEESIDLSEPIFNSITNIICIICFGISYENRDPILATIKSFTEGILNSLGNDHLVDIFPWLTIFPNKTVDMIKKNVKIRDEVLSGILEKCKEKFNSDSISSLMDLLIQAKTNADNNNTSEGQGSNAFSDMHILATIADIFGAGIETTASVLSWIIAFLLHNPEVKKKIQKEIDQNIGFSRTPTFNDRNHLLMLEATIREVLRIRPVAPMLIPHRANSDMSIGEFSIPKFTPVIINLWALHHSEKEWDQPDRFMPERFLDPTGSHLITPSLSYLPFGAGARSCIGEVLARQELFLFMAHLLQRFDLDVPDDEQPPCLKGNANVVFLIDPFKVKITVRQAWKDAQAEVNTWRP",
        "proteome": "UP000886700",
        "gene": "CYP17A1",
        "go_terms": [
            {
                "identifier": "GO:0004497",
                "name": "monooxygenase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005506",
                "name": "iron ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016705",
                "name": "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0020037",
                "name": "heme binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a02e61ba6c64bb9a9c779746e03a6c43264a16fb",
        "counters": {
            "domain_architectures": 520850,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 520850
        }
    }
}