"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P70687"	"{'domain_architectures': 520850, 'entries': 12, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'pfam': 1, 'ssf': 1, 'cdd': 1, 'panther': 1, 'prints': 2, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 520850}"	"['A cytochrome P450 monooxygenase involved in corticoid and androgen biosynthesis. Catalyzes 17-alpha hydroxylation of C21 steroids, which is common for both pathways. A second oxidative step, required only for androgen synthesis, involves an acyl-carbon cleavage. The 17-alpha hydroxy intermediates, as part of adrenal glucocorticoids biosynthesis pathway, are precursors of cortisol. Hydroxylates steroid hormones, pregnenolone and progesterone to form 17-alpha hydroxy metabolites, followed by the cleavage of the C17-C20 bond to form C19 steroids, dehydroepiandrosterone (DHEA) and androstenedione. Has 16-alpha hydroxylase activity. Catalyzes 16-alpha hydroxylation of 17-alpha hydroxy pregnenolone, followed by the cleavage of the C17-C20 bond to form 16-alpha-hydroxy DHEA. Also 16-alpha hydroxylates androgens, relevant for estriol synthesis. Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate, and reducing the second into a water molecule, with two electrons provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase)']"	"CYP17A1"	"[{'identifier': 'GO:0004497', 'name': 'monooxygenase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005506', 'name': 'iron ion binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0016705', 'name': 'oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0020037', 'name': 'heme binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"CP17A_MESAU"	"a02e61ba6c64bb9a9c779746e03a6c43264a16fb"	True	False	False	511	"Steroid 17-alpha-hydroxylase/17,20 lyase"	2	"UP000886700"	"MWELVALLLLTLAYFFWSKSKTCGAKSPKSLPFLPLVGSLPFIPRHGHPHVNFFKLQEKYGPIYSLRLGSTTTVIIGQYQLAKEVLVKKGKEFSGRPHMVTLGLLSDQGKGIAFADSGGSWQLHRKLALSSFALFRDGNQKLEKIICQKASSLCDFLLTHNEESIDLSEPIFNSITNIICIICFGISYENRDPILATIKSFTEGILNSLGNDHLVDIFPWLTIFPNKTVDMIKKNVKIRDEVLSGILEKCKEKFNSDSISSLMDLLIQAKTNADNNNTSEGQGSNAFSDMHILATIADIFGAGIETTASVLSWIIAFLLHNPEVKKKIQKEIDQNIGFSRTPTFNDRNHLLMLEATIREVLRIRPVAPMLIPHRANSDMSIGEFSIPKFTPVIINLWALHHSEKEWDQPDRFMPERFLDPTGSHLITPSLSYLPFGAGARSCIGEVLARQELFLFMAHLLQRFDLDVPDDEQPPCLKGNANVVFLIDPFKVKITVRQAWKDAQAEVNTWRP"	"reviewed"	"{'taxId': '10036', 'scientificName': 'Mesocricetus auratus', 'fullName': 'Mesocricetus auratus (Golden hamster)'}"
