GET /api/protein/UniProt/P69933/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P69933",
"id": "HDA_ECO57",
"source_organism": {
"taxId": "83334",
"scientificName": "Escherichia coli O157:H7",
"fullName": "Escherichia coli O157:H7"
},
"name": "DnaA regulatory inactivator Hda",
"description": [
"Mediates the interaction of DNA replication initiator protein DnaA with DNA polymerase subunit beta sliding clamp (dnaN). Stimulates hydrolysis of ATP-DnaA to ADP-DnaA, rendering DnaA inactive for reinitiation, a process called regulatory inhibition of DnaA or RIDA (By similarity)"
],
"length": 233,
"sequence": "MNTPAQLSLPLYLPDDETFASFWPGDNSSLLAALQNVLRQEHSGYIYLWAREGAGRSHLLHAACAELSQRGDAVGYVPLDKRTWFVPEVLDGMEHLSLVCIDNIECIAGDELWEMAIFDLYNRILESGKTRLLITGDRPPRQLNLGLPDLASRLDWGQIYKLQPLSDEDKLQALQLRARLRGFELPEDVGRFLLKRLDREMRTLFMTLDQLDRASITAQRKLTIPFVKEILKL",
"proteome": "UP000000558",
"gene": "hda",
"go_terms": [
{
"identifier": "GO:0032297",
"name": "negative regulation of DNA-templated DNA replication initiation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "44032ada816e1f9e3432afe50b91752cf7856a7d",
"counters": {
"domain_architectures": 3960,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 1,
"ncbifam": 2,
"hamap": 1,
"panther": 1,
"prints": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3960
}
}
}