General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P68572",
        "id": "BDBB_BPSPB",
        "source_organism": {
            "taxId": "2932878",
            "scientificName": "Bacillus phage SPbeta",
            "fullName": "Bacillus phage SPbeta (Bacillus phage SPBc2)"
        },
        "name": "Disulfide bond formation protein B",
        "description": [
            "Important but not absolutely essential for the production of the lantibiotic sublancin 168, it may also be required for the stability of other secreted proteins. Not required for competence for DNA uptake (By similarity)"
        ],
        "length": 148,
        "sequence": "MNTRYVKSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPIILLIGLLKKDLNSIFYVVFLSSIGLIIAFYHYIIQLTQSKSVVCEIGTNSCAKIEVEYLGFITLPLMSSVCFALIFGIGLKLIIKSKKLKQNQHVYN",
        "proteome": "UP000009091",
        "gene": "bdbB",
        "go_terms": [
            {
                "identifier": "GO:0015035",
                "name": "protein-disulfide reductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006457",
                "name": "protein folding",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "bcd468958579df38fa6baaaf5e859cf702a0b30e",
        "counters": {
            "domain_architectures": 15746,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 15746
        }
    }
}