"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P68572"	"{'domain_architectures': 15746, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'pirsf': 1, 'hamap': 1, 'pfam': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 15746}"	"['Important but not absolutely essential for the production of the lantibiotic sublancin 168, it may also be required for the stability of other secreted proteins. Not required for competence for DNA uptake (By similarity)']"	"bdbB"	"[{'identifier': 'GO:0015035', 'name': 'protein-disulfide reductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006457', 'name': 'protein folding', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0016020', 'name': 'membrane', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"BDBB_BPSPB"	"bcd468958579df38fa6baaaf5e859cf702a0b30e"	False	False	False	148	"Disulfide bond formation protein B"	3	"UP000009091"	"MNTRYVKSFFLLLFFLSFFGTMASLFYSEIMHFKPCVLCWYQRIFLYPIPIILLIGLLKKDLNSIFYVVFLSSIGLIIAFYHYIIQLTQSKSVVCEIGTNSCAKIEVEYLGFITLPLMSSVCFALIFGIGLKLIIKSKKLKQNQHVYN"	"reviewed"	"{'taxId': '2932878', 'scientificName': 'Bacillus phage SPbeta', 'fullName': 'Bacillus phage SPbeta (Bacillus phage SPBc2)'}"
