General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P61138",
        "id": "SYUA_ATEGE",
        "source_organism": {
            "taxId": "9509",
            "scientificName": "Ateles geoffroyi",
            "fullName": "Ateles geoffroyi (Black-handed spider monkey)"
        },
        "name": "Alpha-synuclein",
        "description": [
            "Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (By similarity). Participates as a monomer in synaptic vesicle exocytosis by enhancing vesicle priming, fusion and dilation of exocytotic fusion pores (By similarity). Mechanistically, acts by increasing local Ca(2+) release from microdomains which is essential for the enhancement of ATP-induced exocytosis (By similarity). Also acts as a molecular chaperone in its multimeric membrane-bound state, assisting in the folding of synaptic fusion components called SNAREs (Soluble NSF Attachment Protein REceptors) at presynaptic plasma membrane in conjunction with cysteine string protein-alpha/DNAJC5 (By similarity). This chaperone activity is important to sustain normal SNARE-complex assembly during aging (By similarity). Also plays a role in the regulation of the dopamine neurotransmission by associating with the dopamine transporter (DAT1) and thereby modulating its activity (By similarity)"
        ],
        "length": 140,
        "sequence": "MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVTTVAEKTKEQVTSVGGAVVTGVTAVAQKTVEGAGNIAAATGFVKKDHSGKSEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA",
        "proteome": null,
        "gene": "SNCA",
        "go_terms": [
            {
                "identifier": "GO:0014059",
                "name": "regulation of dopamine secretion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba377935bbbad4e8c0f939864858b21a58ebc159",
        "counters": {
            "domain_architectures": 3377,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "prints": 2,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 3377
        }
    }
}