General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P53023",
        "id": "MSP3_GLORO",
        "source_organism": {
            "taxId": "31243",
            "scientificName": "Globodera rostochiensis",
            "fullName": "Globodera rostochiensis (Golden nematode worm)"
        },
        "name": "Major sperm protein 3",
        "description": [
            "Central component in molecular interactions underlying sperm crawling. Forms an extensive filament system that extends from sperm villipoda, along the leading edge of the pseudopod (By similarity)"
        ],
        "length": 126,
        "sequence": "MAQLPPEDIATMPAQKVVFNAPFDNKATYYVRIINPGTKRIGFAFKTTKPKRINMNPPNGVLGPKESVNVAISCDAFDPSSEDSKGDRVTVEWCNTPDPAAAAFKLEWFQGDGMVRRKNLPIEYNV",
        "proteome": "UP000887572",
        "gene": "MSP-3",
        "go_terms": null,
        "protein_evidence": 2,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15912120c884367a05ea3e431a6fdf0c2c4e326a",
        "counters": {
            "domain_architectures": 18780,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18780
        }
    }
}