"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P53023"	"{'domain_architectures': 18780, 'entries': 9, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'pfam': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 18780}"	"['Central component in molecular interactions underlying sperm crawling. Forms an extensive filament system that extends from sperm villipoda, along the leading edge of the pseudopod (By similarity)']"	"MSP-3"	""	"MSP3_GLORO"	"15912120c884367a05ea3e431a6fdf0c2c4e326a"	True	False	False	126	"Major sperm protein 3"	2	"UP000887572"	"MAQLPPEDIATMPAQKVVFNAPFDNKATYYVRIINPGTKRIGFAFKTTKPKRINMNPPNGVLGPKESVNVAISCDAFDPSSEDSKGDRVTVEWCNTPDPAAAAFKLEWFQGDGMVRRKNLPIEYNV"	"reviewed"	"{'taxId': '31243', 'scientificName': 'Globodera rostochiensis', 'fullName': 'Globodera rostochiensis (Golden nematode worm)'}"