GET /api/protein/UniProt/P40923/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P40923",
"id": "YOX1_SCHPO",
"source_organism": {
"taxId": "284812",
"scientificName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843)",
"fullName": "Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)"
},
"name": "MBF complex negative regulatory component yox1",
"description": [
"Negative regulatory component of the MBF transcription factor complex involved in cell-cycle G1/S phase-specific gene expression and more particularly DNA replication checkpoint-dependent gene expression"
],
"length": 201,
"sequence": "MSLSDSPSKSGNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATLLEQYFLKTPKPSLIERQELSKKLKSSMTPRELQIWFQNKRQSLRRSNCLSRNRLEGTGENSLLRRKSTLTLCETSTGQAELFFQSWPLHSQSVVGEMIHHEQDDYNKENKQQKVVDTTKDISRGSNGNEDSAAHQELEECARSLVELQQQCNDH",
"proteome": "UP000002485",
"gene": "yox1",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cca9db9652b5e6e0313f2eed7be72cec278d12f",
"counters": {
"domain_architectures": 145457,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 145457
}
}
}