"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P40923"	"{'domain_architectures': 145457, 'entries': 10, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'smart': 1, 'pfam': 1, 'cdd': 1, 'panther': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 145457}"	"['Negative regulatory component of the MBF transcription factor complex involved in cell-cycle G1/S phase-specific gene expression and more particularly DNA replication checkpoint-dependent gene expression']"	"yox1"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"YOX1_SCHPO"	"1cca9db9652b5e6e0313f2eed7be72cec278d12f"	True	False	False	201	"MBF complex negative regulatory component yox1"	1	"UP000002485"	"MSLSDSPSKSGNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATLLEQYFLKTPKPSLIERQELSKKLKSSMTPRELQIWFQNKRQSLRRSNCLSRNRLEGTGENSLLRRKSTLTLCETSTGQAELFFQSWPLHSQSVVGEMIHHEQDDYNKENKQQKVVDTTKDISRGSNGNEDSAAHQELEECARSLVELQQQCNDH"	"reviewed"	"{'taxId': '284812', 'scientificName': 'Schizosaccharomyces pombe (strain 972 / ATCC 24843)', 'fullName': 'Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)'}"