GET /api/protein/UniProt/P40040/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P40040",
"id": "THO1_YEAST",
"source_organism": {
"taxId": "559292",
"scientificName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)",
"fullName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)"
},
"name": "Protein THO1",
"description": [
"Facilitates RNA binding of SUB2 and likely plays a role in mRNA export (PubMed:37578863). Suppressor of the transcriptional defect of HPR1 by overexpression"
],
"length": 218,
"sequence": "MADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQEQNQEQGSEPAAIEEPASQNITEKKEVSSEPKETNEPKEENKDVQKPSDGPSATASENEQAAASTAAPALSPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGLVSRKNEPESGNNGKFKNRNKNANNRSRVSKNRRGNRSGYRR",
"proteome": "UP000002311",
"gene": "THO1",
"go_terms": null,
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c40a8bf02782dc20a6a9f67f24d48f0d3db562ee",
"counters": {
"domain_architectures": 1471,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 5,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 2,
"smart": 1,
"profile": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1471
}
}
}