GET /api/protein/UniProt/P40040/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P40040",
        "id": "THO1_YEAST",
        "source_organism": {
            "taxId": "559292",
            "scientificName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c)",
            "fullName": "Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)"
        },
        "name": "Protein THO1",
        "description": [
            "Facilitates RNA binding of SUB2 and likely plays a role in mRNA export (PubMed:37578863). Suppressor of the transcriptional defect of HPR1 by overexpression"
        ],
        "length": 218,
        "sequence": "MADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQEQNQEQGSEPAAIEEPASQNITEKKEVSSEPKETNEPKEENKDVQKPSDGPSATASENEQAAASTAAPALSPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGLVSRKNEPESGNNGKFKNRNKNANNRSRVSKNRRGNRSGYRR",
        "proteome": "UP000002311",
        "gene": "THO1",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c40a8bf02782dc20a6a9f67f24d48f0d3db562ee",
        "counters": {
            "domain_architectures": 1471,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 5,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 2,
                "smart": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1471
        }
    }
}