"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P40040"	"{'domain_architectures': 1471, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 5, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 2, 'smart': 1, 'profile': 1, 'panther': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 1471}"	"['Facilitates RNA binding of SUB2 and likely plays a role in mRNA export (PubMed:37578863). Suppressor of the transcriptional defect of HPR1 by overexpression']"	"THO1"	""	"THO1_YEAST"	"c40a8bf02782dc20a6a9f67f24d48f0d3db562ee"	True	False	False	218	"Protein THO1"	1	"UP000002311"	"MADYSSLTVVQLKDLLTKRNLSVGGLKNELVQRLIKDDEESKGESEVSPQEQNQEQGSEPAAIEEPASQNITEKKEVSSEPKETNEPKEENKDVQKPSDGPSATASENEQAAASTAAPALSPEEIKAKALDLLNKKLHRANKFGQDQADIDSLQRQINRVEKFGVDLNSKLAEELGLVSRKNEPESGNNGKFKNRNKNANNRSRVSKNRRGNRSGYRR"	"reviewed"	"{'taxId': '559292', 'scientificName': 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)', 'fullName': ""Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)""}"