General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P37853",
        "id": "CHLB_PICMA",
        "source_organism": {
            "taxId": "3335",
            "scientificName": "Picea mariana",
            "fullName": "Picea mariana (Black spruce)"
        },
        "name": "Light-independent protochlorophyllide reductase subunit B",
        "description": [
            "Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The NB-protein (ChlN-ChlB) is the catalytic component of the complex (By similarity)"
        ],
        "length": 104,
        "sequence": "RRLLKDLDIRINQIIPEGGSVEDSKNLPKARFNLIPYREVGLMTAMYLNKEFGMPYVSTTPMGAVDMAECIRQIKKYIDTLAAPILSSKRVDYESYIDGQTRFV",
        "proteome": null,
        "gene": "chlB",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "030cfccd83fcef6aaed33f7dcb7700a738157b28",
        "counters": {
            "domain_architectures": 16808,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 16808
        }
    }
}