"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P37853"	"{'domain_architectures': 16808, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'panther': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 16808}"	"['Component of the dark-operative protochlorophyllide reductase (DPOR) that uses Mg-ATP and reduced ferredoxin to reduce ring D of protochlorophyllide (Pchlide) to form chlorophyllide a (Chlide). This reaction is light-independent. The NB-protein (ChlN-ChlB) is the catalytic component of the complex (By similarity)']"	"chlB"	"[{'identifier': 'GO:0016491', 'name': 'oxidoreductase activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"CHLB_PICMA"	"030cfccd83fcef6aaed33f7dcb7700a738157b28"	True	False	True	104	"Light-independent protochlorophyllide reductase subunit B"	3	""	"RRLLKDLDIRINQIIPEGGSVEDSKNLPKARFNLIPYREVGLMTAMYLNKEFGMPYVSTTPMGAVDMAECIRQIKKYIDTLAAPILSSKRVDYESYIDGQTRFV"	"reviewed"	"{'taxId': '3335', 'scientificName': 'Picea mariana', 'fullName': 'Picea mariana (Black spruce)'}"