General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P32101",
        "id": "RLP7_CYBJA",
        "source_organism": {
            "taxId": "4903",
            "scientificName": "Cyberlindnera jadinii",
            "fullName": "Cyberlindnera jadinii (Torula yeast)"
        },
        "name": "Ribosome biogenesis protein RLP7",
        "description": [
            "Involved in the biogenesis of the 60S ribosomal subunit. May act as a specificity factor that binds precursor rRNAs and tethers the enzymes that carry out the early 5' to 3' exonucleolytic reactions that generate the mature rRNAs (By similarity)"
        ],
        "length": 212,
        "sequence": "LVSDASNTKSYISRVAQDGSKSKEIYSGKPTLYLIVRTPGPVGAKIPSKVQKVLQLLRLNKINSGVFVKLTETVYPLLKLLSPYTVIXQPSLQTVRQLVQKRATVTVTHANDEEPRQVKLNDNNLVEEKLGDEGIICIEDIIHETSHLATTFKTVTHFLDPFELNKDVVGYGPLAKLRKLEKQEAEKQRKTSNSGSAPILEIDIDDFVAQQN",
        "proteome": null,
        "gene": "RLP7",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "reviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "2c8484a15f6278a8dcdec4735d6c22a76d94f122",
        "counters": {
            "domain_architectures": 26014,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26014
        }
    }
}