"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P32101"	"{'domain_architectures': 26014, 'entries': 11, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'cathgene3d': 1, 'ssf': 1, 'cdd': 1, 'pfam': 1, 'panther': 1, 'prosite': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 26014}"	"[""Involved in the biogenesis of the 60S ribosomal subunit. May act as a specificity factor that binds precursor rRNAs and tethers the enzymes that carry out the early 5' to 3' exonucleolytic reactions that generate the mature rRNAs (By similarity)""]"	"RLP7"	""	"RLP7_CYBJA"	"2c8484a15f6278a8dcdec4735d6c22a76d94f122"	False	False	True	212	"Ribosome biogenesis protein RLP7"	3	""	"LVSDASNTKSYISRVAQDGSKSKEIYSGKPTLYLIVRTPGPVGAKIPSKVQKVLQLLRLNKINSGVFVKLTETVYPLLKLLSPYTVIXQPSLQTVRQLVQKRATVTVTHANDEEPRQVKLNDNNLVEEKLGDEGIICIEDIIHETSHLATTFKTVTHFLDPFELNKDVVGYGPLAKLRKLEKQEAEKQRKTSNSGSAPILEIDIDDFVAQQN"	"reviewed"	"{'taxId': '4903', 'scientificName': 'Cyberlindnera jadinii', 'fullName': 'Cyberlindnera jadinii (Torula yeast)'}"