GET /api/protein/UniProt/P28021/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "P28021",
"id": "CSK2B_XENLA",
"source_organism": {
"taxId": "8355",
"scientificName": "Xenopus laevis",
"fullName": "Xenopus laevis (African clawed frog)"
},
"name": "Casein kinase II subunit beta",
"description": [
"Regulatory subunit of casein kinase II/CK2. As part of the kinase complex regulates the basal catalytic activity of the alpha subunit a constitutively active serine/threonine-protein kinase that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine (By similarity). Participates in Wnt signaling"
],
"length": 215,
"sequence": "MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTMR",
"proteome": "UP000186698",
"gene": "csnk2b",
"go_terms": [
{
"identifier": "GO:0019887",
"name": "protein kinase regulator activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005956",
"name": "protein kinase CK2 complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 1,
"source_database": "reviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cc4e2085f38f95f05fe8384a6e8941f815d79186",
"counters": {
"domain_architectures": 9214,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 1,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 9214
}
}
}