"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P28021"	"{'domain_architectures': 9214, 'entries': 11, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 1, 'taxa': 1, 'dbEntries': {'cathgene3d': 2, 'ssf': 1, 'pfam': 1, 'smart': 1, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 3}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 9214}"	"['Regulatory subunit of casein kinase II/CK2. As part of the kinase complex regulates the basal catalytic activity of the alpha subunit a constitutively active serine/threonine-protein kinase that phosphorylates a large number of substrates containing acidic residues C-terminal to the phosphorylated serine or threonine (By similarity). Participates in Wnt signaling']"	"csnk2b"	"[{'identifier': 'GO:0019887', 'name': 'protein kinase regulator activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005956', 'name': 'protein kinase CK2 complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"CSK2B_XENLA"	"cc4e2085f38f95f05fe8384a6e8941f815d79186"	True	False	False	215	"Casein kinase II subunit beta"	1	"UP000186698"	"MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTMR"	"reviewed"	"{'taxId': '8355', 'scientificName': 'Xenopus laevis', 'fullName': 'Xenopus laevis (African clawed frog)'}"