General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P22576",
        "id": "STP_SHV2C",
        "source_organism": {
            "taxId": "10384",
            "scientificName": "Saimiriine herpesvirus 2 (strain 488)",
            "fullName": "Saimiriine herpesvirus 2 (strain 488) (SaHV-2)"
        },
        "name": "Saimiri transformation-associated protein",
        "description": [
            "Acts synergistically with Tip to stimulate NF-kappa-B activity and interleukin-2 gene expression by binding to host TRAF proteins. Activation of NF-kappa-B protects lymphocytes from apoptosis, thereby facilitating viral induced cell transformation"
        ],
        "length": 102,
        "sequence": "MASEPNLRYPIEETGDRGPPGPPGPPGPQGPPGPQGPPGPQGPPGPPGPPGPPGPPGPPGPPGPPGPPGLPGLFVTNLLLGIIVLLLLIIVALLLVSKLVVN",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "49732666fb6c8d8c2c91340a4e76f257605d1108",
        "counters": {
            "domain_architectures": 17957,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 17957
        }
    }
}