"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P22576"	"{'domain_architectures': 17957, 'entries': 6, 'isoforms': 0, 'proteomes': 0, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'pfam': 1, 'pirsf': 1, 'panther': 1, 'interpro': 3}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 17957}"	"['Acts synergistically with Tip to stimulate NF-kappa-B activity and interleukin-2 gene expression by binding to host TRAF proteins. Activation of NF-kappa-B protects lymphocytes from apoptosis, thereby facilitating viral induced cell transformation']"	""	""	"STP_SHV2C"	"49732666fb6c8d8c2c91340a4e76f257605d1108"	False	False	False	102	"Saimiri transformation-associated protein"	4	""	"MASEPNLRYPIEETGDRGPPGPPGPPGPQGPPGPQGPPGPQGPPGPPGPPGPPGPPGPPGPPGPPGPPGLPGLFVTNLLLGIIVLLLLIIVALLLVSKLVVN"	"reviewed"	"{'taxId': '10384', 'scientificName': 'Saimiriine herpesvirus 2 (strain 488)', 'fullName': 'Saimiriine herpesvirus 2 (strain 488) (SaHV-2)'}"