General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P13976",
        "id": "PEMK_ECOLX",
        "source_organism": {
            "taxId": "562",
            "scientificName": "Escherichia coli",
            "fullName": "Escherichia coli"
        },
        "name": "Endoribonuclease PemK",
        "description": [
            "Toxic component of a type II toxin-antitoxin (TA) system. Probably functions as an endoribonuclease. Responsible for the stable maintenance of the plasmid during cell division by postsegregational killing of plasmid-less daughter cells. Neutralized by coexpression with cognate antitoxin PemI. Both PemI and PemK proteins bind to the promoter region of the pem operon to autoregulate their synthesis"
        ],
        "length": 133,
        "sequence": "MLKYQLKNENGWMHRRLVRRKSDMERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT",
        "proteome": null,
        "gene": "pemK",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6e3f62dc624dc325f1d2ec1e014ba61b662cfc2b",
        "counters": {
            "domain_architectures": 25382,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 2,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 25382
        }
    }
}