"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P13976"	"{'domain_architectures': 25382, 'entries': 7, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 2, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 1, 'pfam': 1, 'panther': 1, 'pirsf': 1, 'interpro': 2}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 25382}"	"['Toxic component of a type II toxin-antitoxin (TA) system. Probably functions as an endoribonuclease. Responsible for the stable maintenance of the plasmid during cell division by postsegregational killing of plasmid-less daughter cells. Neutralized by coexpression with cognate antitoxin PemI. Both PemI and PemK proteins bind to the promoter region of the pem operon to autoregulate their synthesis']"	"pemK"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"PEMK_ECOLX"	"6e3f62dc624dc325f1d2ec1e014ba61b662cfc2b"	True	False	False	133	"Endoribonuclease PemK"	1	""	"MLKYQLKNENGWMHRRLVRRKSDMERGEIWLVSLDPTAGHEQQGTRPVLIVTPAAFNRVTRLPVVVPVTSGGNFARTAGFAVSLDGVGIRTTGVVRCDQPRTIDMKARGGKRLERVPETIMNEVLGRLSTILT"	"reviewed"	"{'taxId': '562', 'scientificName': 'Escherichia coli', 'fullName': 'Escherichia coli'}"