General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0DXB6",
        "id": "CGLR_MICDL",
        "source_organism": {
            "taxId": "69319",
            "scientificName": "Microplitis demolitor",
            "fullName": "Microplitis demolitor (Parasitoid wasp)"
        },
        "name": "Cyclic GMP-AMP synthase-like receptor",
        "description": [
            "Nucleotidyltransferase that catalyzes the formation of cyclic GMP-AMP (2',3'-cGAMP) from ATP and GTP and plays a key role in innate immunity (PubMed:37379839). Acts as a key sensor of double-stranded RNA (dsRNA), the presence of dsRNA in the cytoplasm being a danger signal that triggers the immune responses (PubMed:37379839). Directly binds dsRNA, activating the nucleotidyltransferase activity, leading to synthesis of 2',3'-cGAMP, a second messenger that binds to and activates Sting, thereby triggering the immune response via activation of the NF-kappa-B transcription factor (PubMed:37379839)"
        ],
        "length": 520,
        "sequence": "MNGDEQNKKKLRSDAMFGKINQFVTLQKDETAKYNSLFTKVTESIVSILKEKDEVFKKYYRNTMYAGSFYKQTRVGQPKEFDLNLILCLPDIDSVKIEKGRPGFAKIKFDERKISSVWTEHKVLNKWLDSEGYLDNGKLRGWFEGMVKKSLNPSEKNSNKFRIYSKDSSSPLCEAEIKKSGPAFTLIVNDGSMEFAVDLVPVLEFSQSPPLSNFEKLKEPWHLVPKPLKNGDVPNQNWRYCFYHYEKEMLKKNGKVKPIIRHIKKLRDTQNWSILASYYIETLFFHVLSKNDFDQNESQTRLLVYMLKELSKAFKSGLLNYFWDKTFNLFGELTEDQIVGVQNRLDKIIKEIEADPTTMTQYFLTKEEQKKLKEIEEKEKTQPKKEVNVDKTNGLSSTFPLIRETKSEKNKKIIQESENRETSKNEIKALKEMVLSLKAEFKDFKNSIKQKPIDQTPETEGTDEKEMKKLLLLLINEVKQLKLNVGRLETKIDQTNEQIKNIKSQSTFFDVMETGVPLLN",
        "proteome": null,
        "gene": "cGLR",
        "go_terms": null,
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3aebc1c0b41b5199648bfafd6f9a02a39a1a71ac",
        "counters": {
            "domain_architectures": 7552,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "smart": 1,
                "pfam": 2,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 7552
        }
    }
}