General Handler

HTTP 200 OK
Allow: GET, HEAD
Cached: true
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Server-Timing: 
Vary: Accept

{
    "metadata": {
        "accession": "P0DMM8",
        "id": "SCX1_TITTR",
        "source_organism": {
            "taxId": "369776",
            "scientificName": "Tityus trivittatus",
            "fullName": "Tityus trivittatus (Argentinean scorpion)"
        },
        "name": "Beta-mammal Tt1g",
        "description": [
            "Beta toxins modify sodium channel function in two ways: an excitatory effect (shifting the activation process to more negative potential) and/or a depressant effect (reducing the peak current). At concentration of 500 nM this toxin produces channel opening at more negative potentials in hNav1.2/SCN2A and hNav1.3/SCN3A, which shows the biggest effect. On the other hand the peak current is decreased in hNav1.4/SCN4A and hNav1.5/SCN5A channels, without apparent modification of the activation gate. This toxin is active against mammals"
        ],
        "length": 84,
        "sequence": "MKGMILFISCILLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECAIKKGSSGYCAWPACYCYGLPNWVKVWERATNRCGKK",
        "proteome": null,
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0006952",
                "name": "defense response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008200",
                "name": "ion channel inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019871",
                "name": "sodium channel inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0090729",
                "name": "toxin activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "91cf9b65efdbf553bdb99b3376bcd79a3f1ef44f",
        "counters": {
            "domain_architectures": 1101,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1101
        }
    }
}