"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"P0DMM8"	"{'domain_architectures': 1101, 'entries': 12, 'isoforms': 0, 'proteomes': 0, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'smart': 1, 'pfam': 1, 'cathgene3d': 1, 'ssf': 1, 'profile': 1, 'cdd': 1, 'prints': 1, 'interpro': 5}, 'proteome': 0, 'taxonomy': 1, 'similar_proteins': 1101}"	"['Beta toxins modify sodium channel function in two ways: an excitatory effect (shifting the activation process to more negative potential) and/or a depressant effect (reducing the peak current). At concentration of 500 nM this toxin produces channel opening at more negative potentials in hNav1.2/SCN2A and hNav1.3/SCN3A, which shows the biggest effect. On the other hand the peak current is decreased in hNav1.4/SCN4A and hNav1.5/SCN5A channels, without apparent modification of the activation gate. This toxin is active against mammals']"	""	"[{'identifier': 'GO:0006952', 'name': 'defense response', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0008200', 'name': 'ion channel inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0019871', 'name': 'sodium channel inhibitor activity', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0005576', 'name': 'extracellular region', 'category': {'code': 'C', 'name': 'cellular_component'}}, {'identifier': 'GO:0090729', 'name': 'toxin activity', 'category': {'code': 'F', 'name': 'molecular_function'}}]"	"SCX1_TITTR"	"91cf9b65efdbf553bdb99b3376bcd79a3f1ef44f"	True	False	False	84	"Beta-mammal Tt1g"	1	""	"MKGMILFISCILLIGIVVECKEGYLMDHEGCKLSCFIRPSGYCGRECAIKKGSSGYCAWPACYCYGLPNWVKVWERATNRCGKK"	"reviewed"	"{'taxId': '369776', 'scientificName': 'Tityus trivittatus', 'fullName': 'Tityus trivittatus (Argentinean scorpion)'}"