General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "P0DJL7",
        "id": "DTXR_CORDI",
        "source_organism": {
            "taxId": "257309",
            "scientificName": "Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)",
            "fullName": "Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)"
        },
        "name": "Diphtheria toxin repressor",
        "description": [
            "Iron-binding repressor of the dipheteria toxin gene expression. May serve as a global regulator of gene expression. Represses ripA under iron excess"
        ],
        "length": 226,
        "sequence": "MKDLVDTTEMYLRTIYELEEEGVTPLRARIAERLEQSGPTVSQTVARMERDGLVVVASDRSLQMTPTGRTLATAVMRKHRLAERLLTDIIGLDINKVHDEACRWEHVMSDEVERRLVKVLKDVSRSPFGNPIPGLDELGVGNSDAAVPGTRVIDAATSMPRKVRIVQINEIFQVETDQFTQLLDADIRVGSEVEIVDRDGHITLSHNGKDVELIDDLAHTIRIEEL",
        "proteome": "UP000002198",
        "gene": "dtxR",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046914",
                "name": "transition metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0046983",
                "name": "protein dimerization activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 1,
        "source_database": "reviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cc0452815701435fe8fa83d0078a95c9591031ec",
        "counters": {
            "domain_architectures": 1114,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 24,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "ssf": 3,
                "pfam": 3,
                "profile": 1,
                "smart": 2,
                "panther": 1,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1114
        }
    }
}